General Information

  • ID:  hor002758
  • Uniprot ID:  A0A8J5N159
  • Protein name:  NA
  • Gene name:  ST13-L
  • Organism:  Homarus americanus (American lobster)
  • Family:  FAM10 family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0046983 protein dimerization activity
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  EVEEPEAPAPPAK
  • Length:  13(168-180)
  • Propeptide:  MRSEHTAIVYPGTSNAVANQAHYDAETHRDKMPTTRSSGRRKAPELKEVLPVKKGRKAPKSRAPEPEKAEEPEVVPEKKEKESAAAKEEPEENGEANGDANGEENGVKEEEAKEEEEPMEEEPAKEEEETKEEAKEEEAAKEEEEEAPKKEEVAEEKENEPEANGAEEVEEPEAPAPPAKGRRGRKPRKATVEHCVFKRNAVQVTDGIRAEFPNIVVELNPQKPRSKTFEITITFDDGKSELVWSGLKKGPPRKY
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002758_AF2.pdbhor002758_ESM.pdb

Physical Information

Mass: 157770 Formula: C60H94N14O22
Absent amino acids: CDFGHILMNQRSTWY Common amino acids: EP
pI: 3.82 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 4
Hydrophobicity: -113.08 Boman Index: -2332
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 45.38
Instability Index: 13656.92 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18304551
  • Title:  Mass Spectral Characterization of Peptide Transmitters/Hormones in the Nervous System and Neuroendocrine Organs of the American Lobster Homarus Americanus